| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
| Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
| Protein DsrB insert domain [160277] (2 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [160279] (9 PDB entries) Uniprot Q59110 197-261 |
| Domain d3mm6b3: 3mm6 B:197-261 [213383] Other proteins in same PDB: d3mm6a1, d3mm6a2, d3mm6a3, d3mm6b1, d3mm6b2, d3mm6d1, d3mm6d2, d3mm6d3, d3mm6e1, d3mm6e2 automated match to d3mmcb1 complexed with cyn, sf4, srm |
PDB Entry: 3mm6 (more details), 1.9 Å
SCOPe Domain Sequences for d3mm6b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mm6b3 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
rtppipndeairktceipstvaacptgalkpdmknktikvdvekcmycgncytmcpgmpl
fdpen
Timeline for d3mm6b3: