Lineage for d3mm5e3 (3mm5 E:197-261)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1413689Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1413821Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1413879Protein DsrB insert domain [160277] (2 species)
  7. 1413880Species Archaeoglobus fulgidus [TaxId:2234] [160279] (8 PDB entries)
    Uniprot Q59110 197-261
  8. 1413882Domain d3mm5e3: 3mm5 E:197-261 [213377]
    Other proteins in same PDB: d3mm5a1, d3mm5a2, d3mm5a3, d3mm5b1, d3mm5b2, d3mm5d1, d3mm5d2, d3mm5d3, d3mm5e1, d3mm5e2
    automated match to d3mmcb1
    complexed with sf4, so3, srm

Details for d3mm5e3

PDB Entry: 3mm5 (more details), 1.8 Å

PDB Description: dissimilatory sulfite reductase in complex with the substrate sulfite
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mm5e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mm5e3 d.58.1.5 (E:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
rtppipndeairktceipstvaacptgalkpdmknktikvdvekcmycgncytmcpgmpl
fdpen

SCOPe Domain Coordinates for d3mm5e3:

Click to download the PDB-style file with coordinates for d3mm5e3.
(The format of our PDB-style files is described here.)

Timeline for d3mm5e3: