Lineage for d3mm5d1 (3mm5 D:1-166)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955424Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955470Family d.58.36.2: DsrA/DsrB N-terminal-domain-like [160336] (2 proteins)
    Dissimilatory sulfite reductase is a heterodimer of homologous DsrA and DsrB subunits, the assembly of which is similar to the architecture of duplicated sulfite reductase CysI
  6. 2955471Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160337] (2 species)
  7. 2955472Species Archaeoglobus fulgidus [TaxId:2234] [160338] (8 PDB entries)
    Uniprot Q59109 2-418
  8. 2955476Domain d3mm5d1: 3mm5 D:1-166 [213372]
    Other proteins in same PDB: d3mm5a2, d3mm5a3, d3mm5b1, d3mm5b2, d3mm5b3, d3mm5d2, d3mm5d3, d3mm5e1, d3mm5e2, d3mm5e3
    automated match to d3mmca2
    complexed with sf4, so3, srm

Details for d3mm5d1

PDB Entry: 3mm5 (more details), 1.8 Å

PDB Description: dissimilatory sulfite reductase in complex with the substrate sulfite
PDB Compounds: (D:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d3mm5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mm5d1 d.58.36.2 (D:1-166) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]}
setplldelekgpwpsfvkeikktaelmekaaaegkdvkmpkgargllkqleisykdkkt
hwkhggivsvvgygggvigrysdlgeqipevehfhtmrinqpsgwfystkalrglcdvwe
kwgsgltnfhgstgdiiflgtrseylqpcfedlgnleipfdiggsg

SCOPe Domain Coordinates for d3mm5d1:

Click to download the PDB-style file with coordinates for d3mm5d1.
(The format of our PDB-style files is described here.)

Timeline for d3mm5d1: