SCOP 1.69: Domain d1cftb2: 1cft B:113-213

Lineage for d1cftb2 (1cft B:113-213)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1cftb2: 1cft B:113-213 [21337]
   Other proteins in same PDB: d1cfta1, d1cfta2, d1cftb1
   part of anti-gp120 (HIV-1) Fab CB 4-1

Details for d1cftb2

PDB Entry: 1cft, 2.8 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated d-peptide

SCOP Domain Sequences for d1cftb2:

Sequence; same for both SEQRES and ATOM records:

>d1cftb2 b.1.1.2 (B:113-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsg
lytlsssvtvtsntwpsqtitcnvahpasstkvdkkieprv

Timeline for d1cftb2:

• d1cftb2 first appeared (with stable ids) in SCOP 1.55
  
• d1cftb2 appears in SCOP 1.67
  
• d1cftb2 appears in SCOP 1.71
  
• d1cftb2 appears in the current release, SCOPe 2.08