Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein DsrA insert domain [160280] (2 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [160282] (8 PDB entries) Uniprot Q59109 240-305 |
Domain d3mm5a3: 3mm5 A:239-304 [213368] Other proteins in same PDB: d3mm5a1, d3mm5a2, d3mm5b1, d3mm5b2, d3mm5b3, d3mm5d1, d3mm5d2, d3mm5e1, d3mm5e2, d3mm5e3 automated match to d3mmca1 complexed with sf4, so3, srm |
PDB Entry: 3mm5 (more details), 1.8 Å
SCOPe Domain Sequences for d3mm5a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mm5a3 d.58.1.5 (A:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]} kddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpka lkpgde
Timeline for d3mm5a3: