SCOPe 2.03: Domain d3mlym1: 3mly M:1-107

Lineage for d3mlym1 (3mly M:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d3mlym1: 3mly M:1-107 [213362]
   Other proteins in same PDB: d3mlyl2, d3mlym2
   automated match to d1lgva1

Details for d3mlym1

PDB Entry: 3mly, 1.7 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 3074 in complex with a ur29 v3 peptide

PDB Compounds: (M:) Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light chain

SCOPe Domain Sequences for d3mlym1:

Sequence; same for both SEQRES and ATOM records:

>d3mlym1 b.1.1.0 (M:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvsaapgqkvtiscsgsssnignnmvswyqqhpgtapklliyenskrpsgip
drfsgsrsgtsatlgiiglqtgdeaeyycatwdgslrtvfgggtkltvls

Timeline for d3mlym1:

• d3mlym1 is new in SCOPe 2.03-stable
  
• d3mlym1 appears in SCOPe 2.04
  
• d3mlym1 appears in the current release, SCOPe 2.08