Lineage for d3mlxl1 (3mlx L:2-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755632Domain d3mlxl1: 3mlx L:2-108 [213356]
    Other proteins in same PDB: d3mlxh2, d3mlxi2, d3mlxl2, d3mlxm2
    automated match to d1q1jl1

Details for d3mlxl1

PDB Entry: 3mlx (more details), 1.9 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 3074 in complex with an mn v3 peptide
PDB Compounds: (L:) Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light chain

SCOPe Domain Sequences for d3mlxl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mlxl1 b.1.1.0 (L:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsaapgqkvtiscsgsssnignnmvswyqqhpgtapklliyenskrpsgipd
rfsgsrsgtsatlgiiglqtgdeaeyycatwdgslrtvfgggtkltvlsq

SCOPe Domain Coordinates for d3mlxl1:

Click to download the PDB-style file with coordinates for d3mlxl1.
(The format of our PDB-style files is described here.)

Timeline for d3mlxl1: