SCOPe 2.04: Domain d3mlwl1: 3mlw L:1-107

Lineage for d3mlwl1 (3mlw L:1-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)

8. Domain d3mlwl1: 3mlw L:1-107 [213352]
   Other proteins in same PDB: d3mlwl2, d3mlwm2
   automated match to d2j6el1
   complexed with po4

Details for d3mlwl1

PDB Entry: 3mlw, 2.7 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 1006-15d in complex with an mn v3 peptide

PDB Compounds: (L:) Human monoclonal anti-HIV-1 gp120 V3 antibody 1006-15D Fab light chain

SCOPe Domain Sequences for d3mlwl1:

Sequence; same for both SEQRES and ATOM records:

>d3mlwl1 b.1.1.1 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsasgtpgqrvtiscsgnssniennyvywyqqlpgstpkllifrddqrpsgvp
drfsgsksgtsaslaisglrsedeadyycaswddsrggpdyvfgtgtkvtvlg

Timeline for d3mlwl1:

• d3mlwl1 first appeared in SCOPe 2.03
  
• d3mlwl1 appears in SCOPe 2.05
  
• d3mlwl1 appears in the current release, SCOPe 2.08