Lineage for d3mlvm1 (3mlv M:1-112)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296503Domain d3mlvm1: 3mlv M:1-112 [213350]
    Other proteins in same PDB: d3mlvl2, d3mlvm2
    automated match to d1q1jl1

Details for d3mlvm1

PDB Entry: 3mlv (more details), 2.48 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 2557 in complex with an nof v3 peptide
PDB Compounds: (M:) Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain

SCOPe Domain Sequences for d3mlvm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mlvm1 b.1.1.0 (M:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sylltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgegtrltvlaq

SCOPe Domain Coordinates for d3mlvm1:

Click to download the PDB-style file with coordinates for d3mlvm1.
(The format of our PDB-style files is described here.)

Timeline for d3mlvm1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mlvm2