Lineage for d3mltg2 (3mlt G:112-213)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517583Domain d3mltg2: 3mlt G:112-213 [213343]
    Other proteins in same PDB: d3mlta1, d3mltd1, d3mltg1, d3mltl1
    automated match to d2dd8l2

Details for d3mltg2

PDB Entry: 3mlt (more details), 2.49 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 2557 in complex with a ug1033 v3 peptide
PDB Compounds: (G:) Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain

SCOPe Domain Sequences for d3mltg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mltg2 b.1.1.2 (G:112-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapt

SCOPe Domain Coordinates for d3mltg2:

Click to download the PDB-style file with coordinates for d3mltg2.
(The format of our PDB-style files is described here.)

Timeline for d3mltg2: