SCOPe 2.08: Domain d3mltd2: 3mlt D:112-213

Lineage for d3mltd2 (3mlt D:112-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3mltd2: 3mlt D:112-213 [213341]
   Other proteins in same PDB: d3mlta1, d3mltb_, d3mltd1, d3mlte_, d3mltg1, d3mlth_, d3mlti_, d3mltl1
   automated match to d2dd8l2

Details for d3mltd2

PDB Entry: 3mlt, 2.49 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 2557 in complex with a ug1033 v3 peptide

PDB Compounds: (D:) Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain

SCOPe Domain Sequences for d3mltd2:

Sequence; same for both SEQRES and ATOM records:

>d3mltd2 b.1.1.2 (D:112-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapt

Timeline for d3mltd2:

• d3mltd2 first appeared in SCOPe 2.03
  
• d3mltd2 appears in SCOPe 2.07