Lineage for d3mlsm1 (3mls M:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758214Domain d3mlsm1: 3mls M:1-111 [213332]
    Other proteins in same PDB: d3mlsl2, d3mlsm2, d3mlsn2, d3mlso2
    automated match to d2dd8l1

Details for d3mlsm1

PDB Entry: 3mls (more details), 2.5 Å

PDB Description: crystal structure of anti-hiv-1 v3 mab 2557 fab in complex with a hiv- 1 gp120 v3 mimotope
PDB Compounds: (M:) Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain

SCOPe Domain Sequences for d3mlsm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mlsm1 b.1.1.0 (M:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgdgtrltvlg

SCOPe Domain Coordinates for d3mlsm1:

Click to download the PDB-style file with coordinates for d3mlsm1.
(The format of our PDB-style files is described here.)

Timeline for d3mlsm1: