SCOPe 2.07: Domain d3mlsl1: 3mls L:1-111

Lineage for d3mlsl1 (3mls L:1-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3mlsl1: 3mls L:1-111 [213330]
   Other proteins in same PDB: d3mlsl2, d3mlsm2, d3mlsn2, d3mlso2
   automated match to d2dd8l1

Details for d3mlsl1

PDB Entry: 3mls, 2.5 Å

PDB Description: crystal structure of anti-hiv-1 v3 mab 2557 fab in complex with a hiv- 1 gp120 v3 mimotope

PDB Compounds: (L:) Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain

SCOPe Domain Sequences for d3mlsl1:

Sequence; same for both SEQRES and ATOM records:

>d3mlsl1 b.1.1.0 (L:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgdgtrltvlg

Timeline for d3mlsl1:

• d3mlsl1 first appeared in SCOPe 2.03
  
• d3mlsl1 appears in SCOPe 2.06
  
• d3mlsl1 appears in the current release, SCOPe 2.08