Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries) |
Domain d1cfsb2: 1cfs B:113-213 [21333] Other proteins in same PDB: d1cfsa1, d1cfsa2, d1cfsb1 part of anti-gp120 (HIV-1) Fab CB 4-1 |
PDB Entry: 1cfs (more details), 2.75 Å
SCOP Domain Sequences for d1cfsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cfsb2 b.1.1.2 (B:113-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttapsvyplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsg lytlsssvtvtsntwpsqtitcnvahpasstkvdkkieprv
Timeline for d1cfsb2: