Lineage for d3mksd1 (3mks D:269-369)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348558Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 2348559Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 2348560Family a.158.1.1: F-box domain [81381] (4 proteins)
  6. 2348561Protein Cdc4 F-box and linker domains [81912] (1 species)
  7. 2348562Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81913] (2 PDB entries)
  8. 2348564Domain d3mksd1: 3mks D:269-369 [213314]
    Other proteins in same PDB: d3mksa1, d3mksa2, d3mksb2, d3mksc1, d3mksc2, d3mksd2
    automated match to d1nexb1
    complexed with c1c, gol, so4

Details for d3mksd1

PDB Entry: 3mks (more details), 2.6 Å

PDB Description: crystal structure of yeast cdc4/skp1 in complex with an allosteric inhibitor scf-i2
PDB Compounds: (D:) Cell division control protein 4

SCOPe Domain Sequences for d3mksd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mksd1 a.158.1.1 (D:269-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nlkrdlitslpfeislkifnylqfediinslgvsqnwnkiirkstslwkkllisenfvsp
kgfnslnlklsqkypklsqqdrlrlsflenifilknwynpk

SCOPe Domain Coordinates for d3mksd1:

Click to download the PDB-style file with coordinates for d3mksd1.
(The format of our PDB-style files is described here.)

Timeline for d3mksd1: