Class a: All alpha proteins [46456] (289 folds) |
Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
Superfamily a.158.1: F-box domain [81383] (1 family) |
Family a.158.1.1: F-box domain [81381] (4 proteins) |
Protein Cdc4 F-box and linker domains [81912] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81913] (2 PDB entries) |
Domain d3mksd1: 3mks D:269-369 [213314] Other proteins in same PDB: d3mksa1, d3mksa2, d3mksb2, d3mksc1, d3mksc2, d3mksd2 automated match to d1nexb1 complexed with c1c, gol, so4 |
PDB Entry: 3mks (more details), 2.6 Å
SCOPe Domain Sequences for d3mksd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mksd1 a.158.1.1 (D:269-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nlkrdlitslpfeislkifnylqfediinslgvsqnwnkiirkstslwkkllisenfvsp kgfnslnlklsqkypklsqqdrlrlsflenifilknwynpk
Timeline for d3mksd1: