SCOPe 2.03: Domain d3mksd1: 3mks D:269-369

Lineage for d3mksd1 (3mks D:269-369)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.158: F-box domain [81385] (1 superfamily)
   multihelical; interlocked heterodimer with the Skp1 dimerisation domain

4. Superfamily a.158.1: F-box domain [81383] (1 family)

5. Family a.158.1.1: F-box domain [81381] (4 proteins)

6. Protein Cdc4 F-box and linker domains [81912] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81913] (2 PDB entries)

8. Domain d3mksd1: 3mks D:269-369 [213314]
   Other proteins in same PDB: d3mksa1, d3mksa2, d3mksb2, d3mksc1, d3mksc2, d3mksd2
   automated match to d1nexb1
   complexed with c1c, gol, so4

Details for d3mksd1

PDB Entry: 3mks, 2.6 Å

PDB Description: crystal structure of yeast cdc4/skp1 in complex with an allosteric inhibitor scf-i2

PDB Compounds: (D:) Cell division control protein 4

SCOPe Domain Sequences for d3mksd1:

Sequence; same for both SEQRES and ATOM records:

>d3mksd1 a.158.1.1 (D:269-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nlkrdlitslpfeislkifnylqfediinslgvsqnwnkiirkstslwkkllisenfvsp
kgfnslnlklsqkypklsqqdrlrlsflenifilknwynpk

Timeline for d3mksd1:

• d3mksd1 is new in SCOPe 2.03-stable
  
• d3mksd1 appears in SCOPe 2.04
  
• d3mksd1 appears in the current release, SCOPe 2.08