Lineage for d1cfqb2 (1cfq B:113-213)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221037Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [49082] (8 PDB entries)
  8. 221043Domain d1cfqb2: 1cfq B:113-213 [21331]
    Other proteins in same PDB: d1cfqa1, d1cfqb1

Details for d1cfqb2

PDB Entry: 1cfq (more details), 2.8 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41

SCOP Domain Sequences for d1cfqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfqb2 b.1.1.2 (B:113-213) Immunoglobulin (constant domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
akttapsvyplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsg
lytlsssvtvtsntwpsqtitcnvahpasstkvdkkieprv

SCOP Domain Coordinates for d1cfqb2:

Click to download the PDB-style file with coordinates for d1cfqb2.
(The format of our PDB-style files is described here.)

Timeline for d1cfqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cfqb1