![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
![]() | Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [49082] (8 PDB entries) |
![]() | Domain d1cfqb2: 1cfq B:113-213 [21331] Other proteins in same PDB: d1cfqa1, d1cfqb1 |
PDB Entry: 1cfq (more details), 2.8 Å
SCOP Domain Sequences for d1cfqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cfqb2 b.1.1.2 (B:113-213) Immunoglobulin (constant domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain} akttapsvyplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsg lytlsssvtvtsntwpsqtitcnvahpasstkvdkkieprv
Timeline for d1cfqb2: