Lineage for d3mksa1 (3mks A:4-103)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411215Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1411216Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1411217Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1411241Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [82639] (1 species)
    Suppressor of kinetochore protein 1,Scskp1
  7. 1411242Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82640] (2 PDB entries)
  8. 1411243Domain d3mksa1: 3mks A:4-103 [213308]
    Other proteins in same PDB: d3mksa2, d3mksb1, d3mksb2, d3mksc2, d3mksd1, d3mksd2
    automated match to d1nexa2
    complexed with c1c, gol, so4

Details for d3mksa1

PDB Entry: 3mks (more details), 2.6 Å

PDB Description: crystal structure of yeast cdc4/skp1 in complex with an allosteric inhibitor scf-i2
PDB Compounds: (A:) Suppressor of kinetochore protein 1

SCOPe Domain Sequences for d3mksa1:

Sequence, based on SEQRES records: (download)

>d3mksa1 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
snvvlvsgegerftvdkkiaerslllknylndmgddddedddeivmpvpnvrssvlqkvi
ewaehhrdsnfp

Sequence, based on observed residues (ATOM records): (download)

>d3mksa1 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
snvvlvsgegerftvdkkiaerslllknyeivmpvpnvrssvlqkviewaehhrdsnfp

SCOPe Domain Coordinates for d3mksa1:

Click to download the PDB-style file with coordinates for d3mksa1.
(The format of our PDB-style files is described here.)

Timeline for d3mksa1: