SCOPe 2.03: Domain d3mkpc2: 3mkp C:127-208

Lineage for d3mkpc2 (3mkp C:127-208)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein automated matches [226950] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225942] (2 PDB entries)

8. Domain d3mkpc2: 3mkp C:127-208 [213305]
   Other proteins in same PDB: d3mkpa1, d3mkpb1, d3mkpc1, d3mkpd1
   automated match to d1bhta2
   complexed with epe, sgn, so4; mutant

Details for d3mkpc2

PDB Entry: 3mkp, 2.81 Å

PDB Description: crystal structure of 1k1 mutant of hepatocyte growth factor/scatter factor fragment nk1 in complex with heparin

PDB Compounds: (C:) hepatocyte growth factor

SCOPe Domain Sequences for d3mkpc2:

Sequence; same for both SEQRES and ATOM records:

>d3mkpc2 g.14.1.1 (C:127-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nciigegesykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeegg
pwcftsnpevryevcdipqcse

Timeline for d3mkpc2:

• d3mkpc2 is new in SCOPe 2.03-stable
  
• d3mkpc2 appears in SCOPe 2.04
  
• d3mkpc2 appears in the current release, SCOPe 2.08