Class g: Small proteins [56992] (92 folds) |
Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily) alpha+beta fold with two crossing loops |
Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern |
Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins) automatically mapped to Pfam PF00024 |
Protein automated matches [191160] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225941] (1 PDB entry) |
Domain d3mkpc1: 3mkp C:36-126 [213304] Other proteins in same PDB: d3mkpa2, d3mkpb2, d3mkpc2, d3mkpd2 automated match to d1bhta1 complexed with epe, sgn, so4; mutant |
PDB Entry: 3mkp (more details), 2.81 Å
SCOPe Domain Sequences for d3mkpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mkpc1 g.10.1.1 (C:36-126) automated matches {Human (Homo sapiens) [TaxId: 9606]} rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq clwfpfnsmssgvkkefghefdlyenkdyir
Timeline for d3mkpc1: