Lineage for d3mkpa2 (3mkp A:127-208)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638013Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2638014Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2638015Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2638139Protein automated matches [226950] (2 species)
    not a true protein
  7. 2638140Species Human (Homo sapiens) [TaxId:9606] [225942] (12 PDB entries)
  8. 2638154Domain d3mkpa2: 3mkp A:127-208 [213301]
    Other proteins in same PDB: d3mkpa1, d3mkpb1, d3mkpc1, d3mkpd1
    automated match to d1bhta2
    complexed with epe, sgn, so4; mutant

Details for d3mkpa2

PDB Entry: 3mkp (more details), 2.81 Å

PDB Description: crystal structure of 1k1 mutant of hepatocyte growth factor/scatter factor fragment nk1 in complex with heparin
PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d3mkpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mkpa2 g.14.1.1 (A:127-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nciigegesykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeegg
pwcftsnpevryevcdipqcse

SCOPe Domain Coordinates for d3mkpa2:

Click to download the PDB-style file with coordinates for d3mkpa2.
(The format of our PDB-style files is described here.)

Timeline for d3mkpa2: