SCOPe 2.05: Domain d3mkpa1: 3mkp A:36-126

Lineage for d3mkpa1 (3mkp A:36-126)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
   automatically mapped to Pfam PF00024

6. Protein automated matches [191160] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225941] (1 PDB entry)

8. Domain d3mkpa1: 3mkp A:36-126 [213300]
   Other proteins in same PDB: d3mkpa2, d3mkpb2, d3mkpc2, d3mkpd2
   automated match to d1bhta1
   complexed with epe, sgn, so4; mutant

Details for d3mkpa1

PDB Entry: 3mkp, 2.81 Å

PDB Description: crystal structure of 1k1 mutant of hepatocyte growth factor/scatter factor fragment nk1 in complex with heparin

PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d3mkpa1:

Sequence; same for both SEQRES and ATOM records:

>d3mkpa1 g.10.1.1 (A:36-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq
clwfpfnsmssgvkkefghefdlyenkdyir

Timeline for d3mkpa1:

• d3mkpa1 first appeared in SCOPe 2.03
  
• d3mkpa1 appears in SCOPe 2.04
  
• d3mkpa1 appears in SCOPe 2.06
  
• d3mkpa1 appears in the current release, SCOPe 2.08