Lineage for d3mkhd2 (3mkh D:260-427)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708681Species Podospora anserina [TaxId:5145] [225906] (1 PDB entry)
  8. 2708685Domain d3mkhd2: 3mkh D:260-427 [213299]
    Other proteins in same PDB: d3mkha1, d3mkhb1, d3mkhc1, d3mkhd1
    automated match to d1egda1
    complexed with fad, mg, so4

Details for d3mkhd2

PDB Entry: 3mkh (more details), 2 Å

PDB Description: podospora anserina nitroalkane oxidase
PDB Compounds: (D:) nitroalkane oxidase

SCOPe Domain Sequences for d3mkhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mkhd2 a.29.3.0 (D:260-427) automated matches {Podospora anserina [TaxId: 5145]}
gqgakvafgafdgsavlvgamgvglmraafdaalkfakednrggavpllerqafadllsg
vkiqteaaraltwkaahamengpgdydarrelalaakvfcseaavkactdvinavgisay
dlqrpfsdllntavvlpifdggnvgirrrhlqqlmlkptydawsstyg

SCOPe Domain Coordinates for d3mkhd2:

Click to download the PDB-style file with coordinates for d3mkhd2.
(The format of our PDB-style files is described here.)

Timeline for d3mkhd2: