SCOPe 2.03: Domain d3mkhd1: 3mkh D:2-259

Lineage for d3mkhd1 (3mkh D:2-259)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (14 species)
   not a true protein

7. Species Podospora anserina [TaxId:5145] [225905] (1 PDB entry)

8. Domain d3mkhd1: 3mkh D:2-259 [213298]
   Other proteins in same PDB: d3mkha2, d3mkhb2, d3mkhc2, d3mkhd2
   automated match to d1egda2
   complexed with fad, mg, so4

Details for d3mkhd1

PDB Entry: 3mkh, 2 Å

PDB Description: podospora anserina nitroalkane oxidase

PDB Compounds: (D:) nitroalkane oxidase

SCOPe Domain Sequences for d3mkhd1:

Sequence; same for both SEQRES and ATOM records:

>d3mkhd1 e.6.1.0 (D:2-259) automated matches {Podospora anserina [TaxId: 5145]}
aidfhlsasqkgtyqaarslarnllmparqtylqhppnsplrfqstqptyaaavsagilk
gqispahggtggtliesailveecysvepsaaltifatglgltpinlaagpqhaeflapf
lsgegsplaslvfsepggvanalekgapgfqttarlegdewvingekmwatncagwdfkg
cdlacvvcrdattpleegqdpenkvmiilvtradldrngegsfevlrhvatpghtsvsgp
hvrytnvrvptknvlcpa

Timeline for d3mkhd1:

• d3mkhd1 is new in SCOPe 2.03-stable
  
• d3mkhd1 appears in SCOPe 2.04
  
• d3mkhd1 appears in the current release, SCOPe 2.08