SCOPe 2.03: Domain d3mkhc2: 3mkh C:260-427

Lineage for d3mkhc2 (3mkh C:260-427)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (15 species)
   not a true protein

7. Species Podospora anserina [TaxId:5145] [225906] (1 PDB entry)

8. Domain d3mkhc2: 3mkh C:260-427 [213297]
   Other proteins in same PDB: d3mkha1, d3mkhb1, d3mkhc1, d3mkhd1
   automated match to d1egda1
   complexed with fad, mg, so4

Details for d3mkhc2

PDB Entry: 3mkh, 2 Å

PDB Description: podospora anserina nitroalkane oxidase

PDB Compounds: (C:) nitroalkane oxidase

SCOPe Domain Sequences for d3mkhc2:

Sequence; same for both SEQRES and ATOM records:

>d3mkhc2 a.29.3.0 (C:260-427) automated matches {Podospora anserina [TaxId: 5145]}
gqgakvafgafdgsavlvgamgvglmraafdaalkfakednrggavpllerqafadllsg
vkiqteaaraltwkaahamengpgdydarrelalaakvfcseaavkactdvinavgisay
dlqrpfsdllntavvlpifdggnvgirrrhlqqlmlkptydawsstyg

Timeline for d3mkhc2:

• d3mkhc2 is new in SCOPe 2.03-stable
  
• d3mkhc2 appears in SCOPe 2.04
  
• d3mkhc2 appears in the current release, SCOPe 2.08