Lineage for d3mkhc1 (3mkh C:2-259)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451317Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1451318Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1451455Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1451456Protein automated matches [226934] (14 species)
    not a true protein
  7. 1451549Species Podospora anserina [TaxId:5145] [225905] (1 PDB entry)
  8. 1451552Domain d3mkhc1: 3mkh C:2-259 [213296]
    Other proteins in same PDB: d3mkha2, d3mkhb2, d3mkhc2, d3mkhd2
    automated match to d1egda2
    complexed with fad, mg, so4

Details for d3mkhc1

PDB Entry: 3mkh (more details), 2 Å

PDB Description: podospora anserina nitroalkane oxidase
PDB Compounds: (C:) nitroalkane oxidase

SCOPe Domain Sequences for d3mkhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mkhc1 e.6.1.0 (C:2-259) automated matches {Podospora anserina [TaxId: 5145]}
aidfhlsasqkgtyqaarslarnllmparqtylqhppnsplrfqstqptyaaavsagilk
gqispahggtggtliesailveecysvepsaaltifatglgltpinlaagpqhaeflapf
lsgegsplaslvfsepggvanalekgapgfqttarlegdewvingekmwatncagwdfkg
cdlacvvcrdattpleegqdpenkvmiilvtradldrngegsfevlrhvatpghtsvsgp
hvrytnvrvptknvlcpa

SCOPe Domain Coordinates for d3mkhc1:

Click to download the PDB-style file with coordinates for d3mkhc1.
(The format of our PDB-style files is described here.)

Timeline for d3mkhc1: