![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
![]() | Protein automated matches [226935] (30 species) not a true protein |
![]() | Species Podospora anserina [TaxId:5145] [225906] (1 PDB entry) |
![]() | Domain d3mkhb2: 3mkh B:260-427 [213295] Other proteins in same PDB: d3mkha1, d3mkhb1, d3mkhc1, d3mkhd1 automated match to d1egda1 complexed with fad, mg, so4 |
PDB Entry: 3mkh (more details), 2 Å
SCOPe Domain Sequences for d3mkhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mkhb2 a.29.3.0 (B:260-427) automated matches {Podospora anserina [TaxId: 5145]} gqgakvafgafdgsavlvgamgvglmraafdaalkfakednrggavpllerqafadllsg vkiqteaaraltwkaahamengpgdydarrelalaakvfcseaavkactdvinavgisay dlqrpfsdllntavvlpifdggnvgirrrhlqqlmlkptydawsstyg
Timeline for d3mkhb2: