SCOPe 2.03: Domain d3mkga_: 3mkg A:

Lineage for d3mkga_ (3mkg A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein automated matches [190916] (8 species)
   not a true protein

7. Species Solanum lycopersicum [TaxId:4081] [196089] (4 PDB entries)

8. Domain d3mkga_: 3mkg A: [213290]
   automated match to d3pu7b_
   complexed with zn

Details for d3mkga_

PDB Entry: 3mkg, 2.2 Å

PDB Description: Low pH as-isolated tomato chloroplast superoxide dismutase

PDB Compounds: (A:) Superoxide dismutase [Cu-Zn], chloroplastic

SCOPe Domain Sequences for d3mkga_:

Sequence, based on SEQRES records:

>d3mkga_ b.1.8.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg
ahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvhe
leddlgkgghelslttgnaggrlacgvvgltpi

Sequence, based on observed residues (ATOM records):

>d3mkga_ b.1.8.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg
ahfnagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvheleddaggrlacgvvg
ltpi

Timeline for d3mkga_:

• d3mkga_ is new in SCOPe 2.03-stable
  
• d3mkga_ appears in SCOPe 2.04
  
• d3mkga_ appears in the current release, SCOPe 2.08