SCOP 1.67: Domain d1hi6b2: 1hi6 B:113-213

Lineage for d1hi6b2 (1hi6 B:113-213)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d1hi6b2: 1hi6 B:113-213 [21329]
   Other proteins in same PDB: d1hi6a1, d1hi6a2, d1hi6b1
   part of anti-gp120 (HIV-1) Fab CB 4-1
   complexed with nh2

Details for d1hi6b2

PDB Entry: 1hi6, 2.55 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide

SCOP Domain Sequences for d1hi6b2:

Sequence; same for both SEQRES and ATOM records:

>d1hi6b2 b.1.1.2 (B:113-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsg
lytlsssvtvtsntwpsqtitcnvahpasstkvdkkieprv

Timeline for d1hi6b2:

• d1hi6b2 first appeared (with stable ids) in SCOP 1.55
  
• d1hi6b2 appears in SCOP 1.65
  
• d1hi6b2 appears in SCOP 1.69
  
• d1hi6b2 appears in the current release, SCOPe 2.08