SCOPe 2.03: Domain d3mjdb_: 3mjd B:

Lineage for d3mjdb_ (3mjd B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (18 species)
   not a true protein

7. Species Francisella tularensis [TaxId:119856] [225884] (1 PDB entry)

8. Domain d3mjdb_: 3mjd B: [213282]
   automated match to d2ps1a_
   complexed with edo, trs

Details for d3mjdb_

PDB Entry: 3mjd, 1.9 Å

PDB Description: 1.9 angstrom crystal structure of orotate phosphoribosyltransferase (pyre) francisella tularensis.

PDB Compounds: (B:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d3mjdb_:

Sequence, based on SEQRES records:

>d3mjdb_ c.61.1.0 (B:) automated matches {Francisella tularensis [TaxId: 119856]}
nlyfqsnamfiefalknqvlkfgeftlksgrispyffnaglfntgaqlatladyyaqlii
ksdvkydilfgpaykgiplvaaistvlalkynidmpyafdrkeakdhgeggvfvgadmtn
kkvlliddvmtagtafyesynklkiinakiagvvlsidrqekakdsdisatkkisqdfni
pvlavtnfesifeyvkenldetmidkfkqyrqkygs

Sequence, based on observed residues (ATOM records):

>d3mjdb_ c.61.1.0 (B:) automated matches {Francisella tularensis [TaxId: 119856]}
nlyfqsnamfiefalknqvlkfgeftlksgrispyffnaglfntgaqlatladyyaqlii
ksdvkydilfgpaykgiplvaaistvlalkynidmpyafdrkgvfvgadmtnkkvllidd
vmtagtafyesynklkiinakiagvvlsidrqekasdisatkkisqdfnipvlavtnfes
ifeyvkenldetmidkfkqyrqkygs

Timeline for d3mjdb_:

• d3mjdb_ is new in SCOPe 2.03-stable
  
• d3mjdb_ appears in SCOPe 2.04
  
• d3mjdb_ appears in the current release, SCOPe 2.08, called d3mjdb1