Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (18 species) not a true protein |
Species Francisella tularensis [TaxId:119856] [225884] (1 PDB entry) |
Domain d3mjdb_: 3mjd B: [213282] automated match to d2ps1a_ complexed with edo, trs |
PDB Entry: 3mjd (more details), 1.9 Å
SCOPe Domain Sequences for d3mjdb_:
Sequence, based on SEQRES records: (download)
>d3mjdb_ c.61.1.0 (B:) automated matches {Francisella tularensis [TaxId: 119856]} nlyfqsnamfiefalknqvlkfgeftlksgrispyffnaglfntgaqlatladyyaqlii ksdvkydilfgpaykgiplvaaistvlalkynidmpyafdrkeakdhgeggvfvgadmtn kkvlliddvmtagtafyesynklkiinakiagvvlsidrqekakdsdisatkkisqdfni pvlavtnfesifeyvkenldetmidkfkqyrqkygs
>d3mjdb_ c.61.1.0 (B:) automated matches {Francisella tularensis [TaxId: 119856]} nlyfqsnamfiefalknqvlkfgeftlksgrispyffnaglfntgaqlatladyyaqlii ksdvkydilfgpaykgiplvaaistvlalkynidmpyafdrkgvfvgadmtnkkvllidd vmtagtafyesynklkiinakiagvvlsidrqekasdisatkkisqdfnipvlavtnfes ifeyvkenldetmidkfkqyrqkygs
Timeline for d3mjdb_: