Lineage for d3mjdb1 (3mjd B:1-208)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891962Species Francisella tularensis [TaxId:119856] [225884] (1 PDB entry)
  8. 2891964Domain d3mjdb1: 3mjd B:1-208 [213282]
    Other proteins in same PDB: d3mjda2, d3mjdb2, d3mjdc2, d3mjdd2
    automated match to d2ps1a_
    complexed with edo, trs

Details for d3mjdb1

PDB Entry: 3mjd (more details), 1.9 Å

PDB Description: 1.9 angstrom crystal structure of orotate phosphoribosyltransferase (pyre) francisella tularensis.
PDB Compounds: (B:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d3mjdb1:

Sequence, based on SEQRES records: (download)

>d3mjdb1 c.61.1.0 (B:1-208) automated matches {Francisella tularensis [TaxId: 119856]}
mfiefalknqvlkfgeftlksgrispyffnaglfntgaqlatladyyaqliiksdvkydi
lfgpaykgiplvaaistvlalkynidmpyafdrkeakdhgeggvfvgadmtnkkvllidd
vmtagtafyesynklkiinakiagvvlsidrqekakdsdisatkkisqdfnipvlavtnf
esifeyvkenldetmidkfkqyrqkygs

Sequence, based on observed residues (ATOM records): (download)

>d3mjdb1 c.61.1.0 (B:1-208) automated matches {Francisella tularensis [TaxId: 119856]}
mfiefalknqvlkfgeftlksgrispyffnaglfntgaqlatladyyaqliiksdvkydi
lfgpaykgiplvaaistvlalkynidmpyafdrkgvfvgadmtnkkvlliddvmtagtaf
yesynklkiinakiagvvlsidrqekasdisatkkisqdfnipvlavtnfesifeyvken
ldetmidkfkqyrqkygs

SCOPe Domain Coordinates for d3mjdb1:

Click to download the PDB-style file with coordinates for d3mjdb1.
(The format of our PDB-style files is described here.)

Timeline for d3mjdb1: