![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
![]() | Protein automated matches [190891] (38 species) not a true protein |
![]() | Species Francisella tularensis [TaxId:119856] [225884] (1 PDB entry) |
![]() | Domain d3mjdb1: 3mjd B:1-208 [213282] Other proteins in same PDB: d3mjda2, d3mjdb2, d3mjdc2, d3mjdd2 automated match to d2ps1a_ complexed with edo, trs |
PDB Entry: 3mjd (more details), 1.9 Å
SCOPe Domain Sequences for d3mjdb1:
Sequence, based on SEQRES records: (download)
>d3mjdb1 c.61.1.0 (B:1-208) automated matches {Francisella tularensis [TaxId: 119856]} mfiefalknqvlkfgeftlksgrispyffnaglfntgaqlatladyyaqliiksdvkydi lfgpaykgiplvaaistvlalkynidmpyafdrkeakdhgeggvfvgadmtnkkvllidd vmtagtafyesynklkiinakiagvvlsidrqekakdsdisatkkisqdfnipvlavtnf esifeyvkenldetmidkfkqyrqkygs
>d3mjdb1 c.61.1.0 (B:1-208) automated matches {Francisella tularensis [TaxId: 119856]} mfiefalknqvlkfgeftlksgrispyffnaglfntgaqlatladyyaqliiksdvkydi lfgpaykgiplvaaistvlalkynidmpyafdrkgvfvgadmtnkkvlliddvmtagtaf yesynklkiinakiagvvlsidrqekasdisatkkisqdfnipvlavtnfesifeyvken ldetmidkfkqyrqkygs
Timeline for d3mjdb1: