Lineage for d1hi6a2 (1hi6 A:108-214)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221037Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [49082] (8 PDB entries)
  8. 221040Domain d1hi6a2: 1hi6 A:108-214 [21328]
    Other proteins in same PDB: d1hi6a1, d1hi6b1

Details for d1hi6a2

PDB Entry: 1hi6 (more details), 2.55 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide

SCOP Domain Sequences for d1hi6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hi6a2 b.1.1.2 (A:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkeinvkwkidgserqngvldswteqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1hi6a2:

Click to download the PDB-style file with coordinates for d1hi6a2.
(The format of our PDB-style files is described here.)

Timeline for d1hi6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hi6a1