Lineage for d3mj8l2 (3mj8 L:108-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519166Species Cricetulus migratorius [TaxId:10032] [225940] (5 PDB entries)
  8. 1519182Domain d3mj8l2: 3mj8 L:108-211 [213278]
    automated match to d1adql2

Details for d3mj8l2

PDB Entry: 3mj8 (more details), 2.94 Å

PDB Description: Crystal structure of HL4E10 Fab, a hamster Ab stimulatory for gammadelta T cells
PDB Compounds: (L:) stimulatory hamster antibody hl4e10 fab light chain

SCOPe Domain Sequences for d3mj8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mj8l2 b.1.1.0 (L:108-211) automated matches {Cricetulus migratorius [TaxId: 10032]}
qpnaapsvtlfppsseelktnqatlvcmingfypadvavtweadgtpitqgvkttqpsks
dskymatsyltmtadawksrntfickvthggntvekslsp

SCOPe Domain Coordinates for d3mj8l2:

Click to download the PDB-style file with coordinates for d3mj8l2.
(The format of our PDB-style files is described here.)

Timeline for d3mj8l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mj8l1