SCOPe 2.03: Domain d3mica1: 3mic A:46-198

Lineage for d3mica1 (3mic A:46-198)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.1: PHM/PNGase F [49742] (2 families)
   members of this superfamily bind peptide substrates
   duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits

5. Family b.121.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein)

6. Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49748] (15 PDB entries)

8. Domain d3mica1: 3mic A:46-198 [213267]
   automated match to d1sdwa1
   complexed with azi, cu, gol, na, ni

Details for d3mica1

PDB Entry: 3mic, 2.42 Å

PDB Description: Oxidized (Cu2+) peptidylglycine alpha-hydroxylating monooxygenase (PHM) with bound azide obtained by co-crystallization

PDB Compounds: (A:) Peptidyl-glycine alpha-amidating monooxygenase

SCOPe Domain Sequences for d3mica1:

Sequence; same for both SEQRES and ATOM records:

>d3mica1 b.121.1.2 (A:46-198) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdt
vhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgsk
yfvlqvhygdisafrdnhkdcsgvsvhltrvpq

Timeline for d3mica1:

• d3mica1 is new in SCOPe 2.03-stable
  
• d3mica1 appears in SCOPe 2.04
  
• d3mica1 appears in the current release, SCOPe 2.08