SCOPe 2.04: Domain d3mi9b2: 3mi9 B:151-261

Lineage for d3mi9b2 (3mi9 B:151-261)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.0: automated matches [227298] (1 protein)
   not a true family

6. Protein automated matches [227124] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226765] (7 PDB entries)

8. Domain d3mi9b2: 3mi9 B:151-261 [213264]
   Other proteins in same PDB: d3mi9a_
   automated match to d2ivxa2
   complexed with zn

Details for d3mi9b2

PDB Entry: 3mi9, 2.1 Å

PDB Description: Crystal structure of HIV-1 Tat complexed with human P-TEFb

PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d3mi9b2:

Sequence, based on SEQRES records:

>d3mi9b2 a.74.1.0 (B:151-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlkriwnwrac

Sequence, based on observed residues (ATOM records):

>d3mi9b2 a.74.1.0 (B:151-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlc

Timeline for d3mi9b2:

• d3mi9b2 first appeared in SCOPe 2.03
  
• d3mi9b2 appears in SCOPe 2.05
  
• d3mi9b2 appears in the current release, SCOPe 2.08