SCOPe 2.03: Domain d3mi8a_: 3mi8 A:

Lineage for d3mi8a_ (3mi8 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188225] (13 PDB entries)

8. Domain d3mi8a_: 3mi8 A: [213261]
   automated match to d2re9a_

Details for d3mi8a_

PDB Entry: 3mi8, 2.95 Å

PDB Description: the structure of tl1a-dcr3 complex

PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 15, secreted form

SCOPe Domain Sequences for d3mi8a_:

Sequence, based on SEQRES records:

>d3mi8a_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkprahltvvrqtptqhfknqfpalhwehelglaftknrmnytnkfllipesgdyfiysq
vtfrgmtsecseirqagrpnkpdsitvvitkvtdsypeptqllmgtksvsevgsnwfqpi
ylgamfslqegdklmvnvsdislvdytkedktffgafll

Sequence, based on observed residues (ATOM records):

>d3mi8a_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkprahltvvrqtptqhfknqfpalhwehelglaftknrmnytnkfllipesgdyfiysq
vtfrgmpdsitvvitkvtdsypeptqllmgtksvsevgsnwfqpiylgamfslqegdklm
vnvsdislvdytkedktffgafll

Timeline for d3mi8a_:

• d3mi8a_ is new in SCOPe 2.03-stable
  
• d3mi8a_ appears in SCOPe 2.04
  
• d3mi8a_ appears in the current release, SCOPe 2.08