Lineage for d3mgvd1 (3mgv D:20-129)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1738330Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) (S)
  5. 1738331Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 1738332Protein Cre recombinase [47825] (1 species)
  7. 1738333Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
    Uniprot P06956 20-341
  8. 1738340Domain d3mgvd1: 3mgv D:20-129 [213259]
    Other proteins in same PDB: d3mgva2, d3mgvb2, d3mgvc2, d3mgvd2
    automated match to d2crxa1
    protein/DNA complex; complexed with vo4

Details for d3mgvd1

PDB Entry: 3mgv (more details), 2.29 Å

PDB Description: Cre recombinase-DNA transition state
PDB Compounds: (D:) Recombinase cre

SCOPe Domain Sequences for d3mgvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgvd1 a.60.9.1 (D:20-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOPe Domain Coordinates for d3mgvd1:

Click to download the PDB-style file with coordinates for d3mgvd1.
(The format of our PDB-style files is described here.)

Timeline for d3mgvd1: