Lineage for d3mgvb1 (3mgv B:20-129)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716296Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) (S)
  5. 2716297Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 2716298Protein Cre recombinase [47825] (1 species)
  7. 2716299Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
    Uniprot P06956 20-341
  8. 2716304Domain d3mgvb1: 3mgv B:20-129 [213255]
    Other proteins in same PDB: d3mgva2, d3mgvb2, d3mgvc2, d3mgvd2
    automated match to d2crxa1
    protein/DNA complex; complexed with vo4

Details for d3mgvb1

PDB Entry: 3mgv (more details), 2.29 Å

PDB Description: Cre recombinase-DNA transition state
PDB Compounds: (B:) Recombinase cre

SCOPe Domain Sequences for d3mgvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgvb1 a.60.9.1 (B:20-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOPe Domain Coordinates for d3mgvb1:

Click to download the PDB-style file with coordinates for d3mgvb1.
(The format of our PDB-style files is described here.)

Timeline for d3mgvb1: