Lineage for d3mgab2 (3mga B:156-403)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510489Species Salmonella enterica [TaxId:90371] [225883] (1 PDB entry)
  8. 2510491Domain d3mgab2: 3mga B:156-403 [213252]
    Other proteins in same PDB: d3mgaa1, d3mgab1
    automated match to d2b20a2
    complexed with cl, gol, mg, na, peg

Details for d3mgab2

PDB Entry: 3mga (more details), 2.4 Å

PDB Description: 2.4 angstrom crystal structure of ferric enterobactin esterase (fes) from salmonella typhimurium
PDB Compounds: (B:) enterochelin esterase

SCOPe Domain Sequences for d3mgab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgab2 c.69.1.0 (B:156-403) automated matches {Salmonella enterica [TaxId: 90371]}
lqpgwdrpetpyspplmmqwhserlgnsrrvwilttgdeapeerplailldgqfwaenmp
vwpalaslthqrllpgavyllidaidtqhrsqelpcnadfwlavqqellpqvravtpfsd
dagrtvvagqsfgglsalyaglnwptrfgcvlsqsgsfwwphritppegevitrlktgal
carglrivleagvrepivfqanqalyaqlntsqqsifwrqvdgghdalcwrggltqglml
lwqplidt

SCOPe Domain Coordinates for d3mgab2:

Click to download the PDB-style file with coordinates for d3mgab2.
(The format of our PDB-style files is described here.)

Timeline for d3mgab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mgab1