SCOPe 2.07: Domain d3mgab2: 3mga B:156-403

Lineage for d3mgab2 (3mga B:156-403)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [225883] (1 PDB entry)

8. Domain d3mgab2: 3mga B:156-403 [213252]
   Other proteins in same PDB: d3mgaa1, d3mgab1
   automated match to d2b20a2
   complexed with cl, gol, mg, na, peg

Details for d3mgab2

PDB Entry: 3mga, 2.4 Å

PDB Description: 2.4 angstrom crystal structure of ferric enterobactin esterase (fes) from salmonella typhimurium

PDB Compounds: (B:) enterochelin esterase

SCOPe Domain Sequences for d3mgab2:

Sequence; same for both SEQRES and ATOM records:

>d3mgab2 c.69.1.0 (B:156-403) automated matches {Salmonella enterica [TaxId: 90371]}
lqpgwdrpetpyspplmmqwhserlgnsrrvwilttgdeapeerplailldgqfwaenmp
vwpalaslthqrllpgavyllidaidtqhrsqelpcnadfwlavqqellpqvravtpfsd
dagrtvvagqsfgglsalyaglnwptrfgcvlsqsgsfwwphritppegevitrlktgal
carglrivleagvrepivfqanqalyaqlntsqqsifwrqvdgghdalcwrggltqglml
lwqplidt

Timeline for d3mgab2:

• d3mgab2 first appeared in SCOPe 2.03
  
• d3mgab2 appears in SCOPe 2.06
  
• d3mgab2 appears in the current release, SCOPe 2.08