SCOPe 2.04: Domain d3mgab1: 3mga B:9-155

Lineage for d3mgab1 (3mga B:9-155)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (39 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [225882] (1 PDB entry)

8. Domain d3mgab1: 3mga B:9-155 [213251]
   Other proteins in same PDB: d3mgaa2, d3mgab2
   automated match to d2b20a1
   complexed with cl, gol, mg, na, peg

Details for d3mgab1

PDB Entry: 3mga, 2.4 Å

PDB Description: 2.4 angstrom crystal structure of ferric enterobactin esterase (fes) from salmonella typhimurium

PDB Compounds: (B:) enterochelin esterase

SCOPe Domain Sequences for d3mgab1:

Sequence; same for both SEQRES and ATOM records:

>d3mgab1 b.1.18.0 (B:9-155) automated matches {Salmonella enterica [TaxId: 90371]}
seawwrtktgpewirekdgnyrvtfwwrdpqgnethspirrvwvyitgvtdhhqnaqpqt
mariagtdvwrwstalsanwrgsycfipterddvfaafapgetpdrnvlregwrqllpqa
iadplnsqswrggrghavsalempdap

Timeline for d3mgab1:

• d3mgab1 first appeared in SCOPe 2.03
  
• d3mgab1 appears in SCOPe 2.05
  
• d3mgab1 appears in the current release, SCOPe 2.08