Lineage for d3mgab1 (3mga B:9-155)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766521Species Salmonella enterica [TaxId:90371] [225882] (1 PDB entry)
  8. 2766523Domain d3mgab1: 3mga B:9-155 [213251]
    Other proteins in same PDB: d3mgaa2, d3mgab2
    automated match to d2b20a1
    complexed with cl, gol, mg, na, peg

Details for d3mgab1

PDB Entry: 3mga (more details), 2.4 Å

PDB Description: 2.4 angstrom crystal structure of ferric enterobactin esterase (fes) from salmonella typhimurium
PDB Compounds: (B:) enterochelin esterase

SCOPe Domain Sequences for d3mgab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgab1 b.1.18.0 (B:9-155) automated matches {Salmonella enterica [TaxId: 90371]}
seawwrtktgpewirekdgnyrvtfwwrdpqgnethspirrvwvyitgvtdhhqnaqpqt
mariagtdvwrwstalsanwrgsycfipterddvfaafapgetpdrnvlregwrqllpqa
iadplnsqswrggrghavsalempdap

SCOPe Domain Coordinates for d3mgab1:

Click to download the PDB-style file with coordinates for d3mgab1.
(The format of our PDB-style files is described here.)

Timeline for d3mgab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mgab2