| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Salmonella enterica [TaxId:90371] [225882] (1 PDB entry) |
| Domain d3mgab1: 3mga B:9-155 [213251] Other proteins in same PDB: d3mgaa2, d3mgab2 automated match to d2b20a1 complexed with cl, gol, mg, na, peg |
PDB Entry: 3mga (more details), 2.4 Å
SCOPe Domain Sequences for d3mgab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mgab1 b.1.18.0 (B:9-155) automated matches {Salmonella enterica [TaxId: 90371]}
seawwrtktgpewirekdgnyrvtfwwrdpqgnethspirrvwvyitgvtdhhqnaqpqt
mariagtdvwrwstalsanwrgsycfipterddvfaafapgetpdrnvlregwrqllpqa
iadplnsqswrggrghavsalempdap
Timeline for d3mgab1: