Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (124 species) not a true protein |
Species Salmonella enterica [TaxId:90371] [225883] (1 PDB entry) |
Domain d3mgaa2: 3mga A:156-403 [213250] Other proteins in same PDB: d3mgaa1, d3mgab1 automated match to d2b20a2 complexed with cl, gol, mg, na, peg |
PDB Entry: 3mga (more details), 2.4 Å
SCOPe Domain Sequences for d3mgaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mgaa2 c.69.1.0 (A:156-403) automated matches {Salmonella enterica [TaxId: 90371]} lqpgwdrpetpyspplmmqwhserlgnsrrvwilttgdeapeerplailldgqfwaenmp vwpalaslthqrllpgavyllidaidtqhrsqelpcnadfwlavqqellpqvravtpfsd dagrtvvagqsfgglsalyaglnwptrfgcvlsqsgsfwwphritppegevitrlktgal carglrivleagvrepivfqanqalyaqlntsqqsifwrqvdgghdalcwrggltqglml lwqplidt
Timeline for d3mgaa2: