Lineage for d3mg3a1 (3mg3 A:4-173)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735903Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 2735904Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
    automatically mapped to Pfam PF09150
  5. 2735905Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins)
  6. 2735910Protein automated matches [227037] (2 species)
    not a true protein
  7. 2735922Species Synechocystis sp. [TaxId:1148] [225877] (8 PDB entries)
  8. 2735931Domain d3mg3a1: 3mg3 A:4-173 [213245]
    Other proteins in same PDB: d3mg3a2, d3mg3b2
    automated match to d1m98a1
    complexed with ech, gol; mutant

Details for d3mg3a1

PDB Entry: 3mg3 (more details), 1.7 Å

PDB Description: crystal structure of the orange carotenoid protein r155l mutant from cyanobacteria synechocystis sp. pcc 6803
PDB Compounds: (A:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d3mg3a1:

Sequence, based on SEQRES records: (download)

>d3mg3a1 a.175.1.1 (A:4-173) automated matches {Synechocystis sp. [TaxId: 1148]}
tidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmql
aenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfva
pipagyqlsananavlatiqglesgqqitvllnavvdmgftagkdgkria

Sequence, based on observed residues (ATOM records): (download)

>d3mg3a1 a.175.1.1 (A:4-173) automated matches {Synechocystis sp. [TaxId: 1148]}
tidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmql
aenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfva
pipagyqlsananavlatiqglesgqqitvllnavvdmgftkria

SCOPe Domain Coordinates for d3mg3a1:

Click to download the PDB-style file with coordinates for d3mg3a1.
(The format of our PDB-style files is described here.)

Timeline for d3mg3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mg3a2