Lineage for d3mg2a2 (3mg2 A:174-312)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896937Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1896938Protein automated matches [190205] (21 species)
    not a true protein
  7. 1897023Species Synechocystis sp. [TaxId:1148] [225878] (3 PDB entries)
  8. 1897028Domain d3mg2a2: 3mg2 A:174-312 [213242]
    Other proteins in same PDB: d3mg2a1, d3mg2b1
    automated match to d1m98a2
    complexed with ech; mutant

Details for d3mg2a2

PDB Entry: 3mg2 (more details), 2.65 Å

PDB Description: crystal structure of the orange carotenoid protein y44s mutant from cyanobacteria synechocystis sp. pcc 6803
PDB Compounds: (A:) Orange Carotenoid Protein

SCOPe Domain Sequences for d3mg2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg2a2 d.17.4.0 (A:174-312) automated matches {Synechocystis sp. [TaxId: 1148]}
epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspkel

SCOPe Domain Coordinates for d3mg2a2:

Click to download the PDB-style file with coordinates for d3mg2a2.
(The format of our PDB-style files is described here.)

Timeline for d3mg2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mg2a1