| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
| Protein automated matches [190205] (21 species) not a true protein |
| Species Synechocystis sp. [TaxId:1148] [225878] (3 PDB entries) |
| Domain d3mg2a2: 3mg2 A:174-312 [213242] Other proteins in same PDB: d3mg2a1, d3mg2b1 automated match to d1m98a2 complexed with ech; mutant |
PDB Entry: 3mg2 (more details), 2.65 Å
SCOPe Domain Sequences for d3mg2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mg2a2 d.17.4.0 (A:174-312) automated matches {Synechocystis sp. [TaxId: 1148]}
epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspkel
Timeline for d3mg2a2: