Lineage for d3mg1b2 (3mg1 B:174-312)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937177Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2937178Protein automated matches [190205] (35 species)
    not a true protein
  7. 2937369Species Synechocystis sp. [TaxId:1148] [225878] (8 PDB entries)
  8. 2937377Domain d3mg1b2: 3mg1 B:174-312 [213240]
    Other proteins in same PDB: d3mg1a1, d3mg1b1
    automated match to d1m98a2
    complexed with ech, gol

Details for d3mg1b2

PDB Entry: 3mg1 (more details), 1.65 Å

PDB Description: crystal structure of the orange carotenoid protein from cyanobacteria synechocystis sp. pcc 6803
PDB Compounds: (B:) Orange Carotenoid Protein

SCOPe Domain Sequences for d3mg1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg1b2 d.17.4.0 (B:174-312) automated matches {Synechocystis sp. [TaxId: 1148]}
epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspkel

SCOPe Domain Coordinates for d3mg1b2:

Click to download the PDB-style file with coordinates for d3mg1b2.
(The format of our PDB-style files is described here.)

Timeline for d3mg1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mg1b1