Lineage for d3mg1b1 (3mg1 B:3-173)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735903Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 2735904Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
    automatically mapped to Pfam PF09150
  5. 2735905Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins)
  6. 2735910Protein automated matches [227037] (2 species)
    not a true protein
  7. 2735922Species Synechocystis sp. [TaxId:1148] [225877] (8 PDB entries)
  8. 2735930Domain d3mg1b1: 3mg1 B:3-173 [213239]
    Other proteins in same PDB: d3mg1a2, d3mg1b2
    automated match to d1m98a1
    complexed with ech, gol

Details for d3mg1b1

PDB Entry: 3mg1 (more details), 1.65 Å

PDB Description: crystal structure of the orange carotenoid protein from cyanobacteria synechocystis sp. pcc 6803
PDB Compounds: (B:) Orange Carotenoid Protein

SCOPe Domain Sequences for d3mg1b1:

Sequence, based on SEQRES records: (download)

>d3mg1b1 a.175.1.1 (B:3-173) automated matches {Synechocystis sp. [TaxId: 1148]}
ftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmq
laenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfv
apipagyqlsananavlatiqglesgqqitvlrnavvdmgftagkdgkria

Sequence, based on observed residues (ATOM records): (download)

>d3mg1b1 a.175.1.1 (B:3-173) automated matches {Synechocystis sp. [TaxId: 1148]}
ftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmq
laenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfv
apipagyqlsananavlatiqglesgqqitvlrnavvdmgftria

SCOPe Domain Coordinates for d3mg1b1:

Click to download the PDB-style file with coordinates for d3mg1b1.
(The format of our PDB-style files is described here.)

Timeline for d3mg1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mg1b2