Class a: All alpha proteins [46456] (290 folds) |
Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily) multihelical; array |
Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains automatically mapped to Pfam PF09150 |
Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins) |
Protein automated matches [227037] (2 species) not a true protein |
Species Synechocystis sp. [TaxId:1148] [225877] (8 PDB entries) |
Domain d3mg1b1: 3mg1 B:3-173 [213239] Other proteins in same PDB: d3mg1a2, d3mg1b2 automated match to d1m98a1 complexed with ech, gol |
PDB Entry: 3mg1 (more details), 1.65 Å
SCOPe Domain Sequences for d3mg1b1:
Sequence, based on SEQRES records: (download)
>d3mg1b1 a.175.1.1 (B:3-173) automated matches {Synechocystis sp. [TaxId: 1148]} ftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmq laenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfv apipagyqlsananavlatiqglesgqqitvlrnavvdmgftagkdgkria
>d3mg1b1 a.175.1.1 (B:3-173) automated matches {Synechocystis sp. [TaxId: 1148]} ftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmq laenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfv apipagyqlsananavlatiqglesgqqitvlrnavvdmgftria
Timeline for d3mg1b1: