![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
![]() | Protein automated matches [190205] (35 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1148] [225878] (8 PDB entries) |
![]() | Domain d3mg1a2: 3mg1 A:174-311 [213238] Other proteins in same PDB: d3mg1a1, d3mg1b1 automated match to d1m98a2 complexed with ech, gol |
PDB Entry: 3mg1 (more details), 1.65 Å
SCOPe Domain Sequences for d3mg1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mg1a2 d.17.4.0 (A:174-311) automated matches {Synechocystis sp. [TaxId: 1148]} epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln pegkiffvaidllaspke
Timeline for d3mg1a2: