Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (42 species) not a true protein |
Species Streptomyces coelicolor [TaxId:1902] [226767] (3 PDB entries) |
Domain d3mfmd1: 3mfm D:10-262 [213231] automated match to d1vrga1 mutant |
PDB Entry: 3mfm (more details), 2.38 Å
SCOPe Domain Sequences for d3mfmd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mfmd1 c.14.1.0 (D:10-262) automated matches {Streptomyces coelicolor [TaxId: 1902]} dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave yvkqllsylpsnn
Timeline for d3mfmd1: