Lineage for d3mfmc2 (3mfm C:263-530)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435650Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2435651Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2436644Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2436645Protein automated matches [190246] (57 species)
    not a true protein
  7. 2437251Species Streptomyces coelicolor [TaxId:1902] [226767] (3 PDB entries)
  8. 2437261Domain d3mfmc2: 3mfm C:263-530 [213230]
    automated match to d1vrga2
    mutant

Details for d3mfmc2

PDB Entry: 3mfm (more details), 2.38 Å

PDB Description: Crystal Structures and Mutational Analyses of Acyl-CoA Carboxylase Subunit of Streptomyces coelicolor
PDB Compounds: (C:) propionyl-CoA carboxylase complex B subunit

SCOPe Domain Sequences for d3mfmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mfmc2 c.14.1.0 (C:263-530) automated matches {Streptomyces coelicolor [TaxId: 1902]}
lseppafpeeadlavtdedaeldtivpdsanqpydmhsviehvlddaeffetqplfapni
ltgfgrvegrpvgivanqpmqfagclditasekaarfvrtcdafnvpvltfvdvpgflpg
vdqehdgiirrgaklifayaeatvplitvitrkafggaynvmgskhlgadlnlawptaqi
avmgaqgavnilhrrtiadagddaeatrarliqeyedallnpytaaergyvdavimpsdt
rrhivrglrqlrtkreslppkkhgnipl

SCOPe Domain Coordinates for d3mfmc2:

Click to download the PDB-style file with coordinates for d3mfmc2.
(The format of our PDB-style files is described here.)

Timeline for d3mfmc2: