Lineage for d3mfmc1 (3mfm C:10-262)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854330Species Streptomyces coelicolor [TaxId:1902] [226767] (3 PDB entries)
  8. 2854343Domain d3mfmc1: 3mfm C:10-262 [213229]
    automated match to d1vrga1
    mutant

Details for d3mfmc1

PDB Entry: 3mfm (more details), 2.38 Å

PDB Description: crystal structures and mutational analyses of acyl-coa carboxylase subunit of streptomyces coelicolor
PDB Compounds: (C:) propionyl-CoA carboxylase complex B subunit

SCOPe Domain Sequences for d3mfmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mfmc1 c.14.1.0 (C:10-262) automated matches {Streptomyces coelicolor [TaxId: 1902]}
dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
yvkqllsylpsnn

SCOPe Domain Coordinates for d3mfmc1:

Click to download the PDB-style file with coordinates for d3mfmc1.
(The format of our PDB-style files is described here.)

Timeline for d3mfmc1: